Anti SUCLA2 pAb (ATL-HPA061528 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA061528-25
  • Immunohistochemical staining of human cerebral cortex, colon, kidney and lymph node using Anti-SUCLA2 antibody HPA061528 (A) shows similar protein distribution across tissues to independent antibody HPA039435 (B).
  • Immunofluorescent staining of human cell line HEK 293 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: succinate-CoA ligase, ADP-forming, beta subunit
Gene Name: SUCLA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022110: 89%, ENSRNOG00000017481: 84%
Entrez Gene ID: 8803
Uniprot ID: Q9P2R7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERD
Gene Sequence PIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERD
Gene ID - Mouse ENSMUSG00000022110
Gene ID - Rat ENSRNOG00000017481
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SUCLA2 pAb (ATL-HPA061528 w/enhanced validation)
Datasheet Anti SUCLA2 pAb (ATL-HPA061528 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SUCLA2 pAb (ATL-HPA061528 w/enhanced validation)