Anti STXBP5 pAb (ATL-HPA049727 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049727-25

• 
• 

Protein Description: syntaxin binding protein 5 (tomosyn)
Gene Name: STXBP5
Alternative Gene Name: LLGL3, tomosyn
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019790: 95%, ENSRNOG00000013351: 93%
Entrez Gene ID: 134957
Uniprot ID: Q5T5C0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDN
• Gene Sequence: SAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDN
• Gene ID - Mouse: ENSMUSG00000019790
• Gene ID - Rat: ENSRNOG00000013351
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STXBP5 pAb (ATL-HPA049727 w/enhanced validation) – 1 Found

Smerekanych, Sasha; Johnson, Travis S; Huang, Kun; Zhang, Yan. Pseudogene-gene functional networks are prognostic of patient survival in breast cancer. Bmc Medical Genomics. 2020;13(Suppl 5):51.