Anti STX12 pAb (ATL-HPA055300)

Atlas Antibodies

SKU:
ATL-HPA055300-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & the Golgi apparatus.
  • Western blot analysis in human cell line U-2197.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: syntaxin 12
Gene Name: STX12
Alternative Gene Name: STX13, STX14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028879: 93%, ENSRNOG00000011804: 93%
Entrez Gene ID: 23673
Uniprot ID: Q86Y82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERET
Gene Sequence KERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERET
Gene ID - Mouse ENSMUSG00000028879
Gene ID - Rat ENSRNOG00000011804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti STX12 pAb (ATL-HPA055300)
Datasheet Anti STX12 pAb (ATL-HPA055300) Datasheet (External Link)
Vendor Page Anti STX12 pAb (ATL-HPA055300) at Atlas Antibodies

Documents & Links for Anti STX12 pAb (ATL-HPA055300)
Datasheet Anti STX12 pAb (ATL-HPA055300) Datasheet (External Link)
Vendor Page Anti STX12 pAb (ATL-HPA055300)