Anti STRAP pAb (ATL-HPA073876 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA073876-25

• 
• 

Protein Description: serine/threonine kinase receptor associated protein
Gene Name: STRAP
Alternative Gene Name: MAWD, pt-wd, UNRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030224: 93%, ENSRNOG00000007134: 93%
Entrez Gene ID: 11171
Uniprot ID: Q9Y3F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHCVRFSPDGELYASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA
• Gene Sequence: IHCVRFSPDGELYASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA
• Gene ID - Mouse: ENSMUSG00000030224
• Gene ID - Rat: ENSRNOG00000007134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.