Protein Description: serine/threonine kinase receptor associated protein
Gene Name: STRAP
Alternative Gene Name: MAWD, pt-wd, UNRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030224: 93%, ENSRNOG00000007134: 93%
Entrez Gene ID: 11171
Uniprot ID: Q9Y3F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STRAP
Alternative Gene Name: MAWD, pt-wd, UNRIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030224: 93%, ENSRNOG00000007134: 93%
Entrez Gene ID: 11171
Uniprot ID: Q9Y3F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IHCVRFSPDGELYASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA |
| Documents & Links for Anti STRAP pAb (ATL-HPA073876 w/enhanced validation) | |
| Datasheet | Anti STRAP pAb (ATL-HPA073876 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti STRAP pAb (ATL-HPA073876 w/enhanced validation) at Atlas |
| Documents & Links for Anti STRAP pAb (ATL-HPA073876 w/enhanced validation) | |
| Datasheet | Anti STRAP pAb (ATL-HPA073876 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti STRAP pAb (ATL-HPA073876 w/enhanced validation) |