Anti STOX2 pAb (ATL-HPA049776)

Atlas Antibodies

SKU:
ATL-HPA049776-100
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
  • Western blot analysis in human cell line SH-SY5Y.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: storkhead box 2
Gene Name: STOX2
Alternative Gene Name: DKFZp762K222
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038143: 94%, ENSRNOG00000009590: 91%
Entrez Gene ID: 56977
Uniprot ID: Q9P2F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTHAPTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPK
Gene Sequence HLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTHAPTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPK
Gene ID - Mouse ENSMUSG00000038143
Gene ID - Rat ENSRNOG00000009590
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti STOX2 pAb (ATL-HPA049776)
Datasheet Anti STOX2 pAb (ATL-HPA049776) Datasheet (External Link)
Vendor Page Anti STOX2 pAb (ATL-HPA049776) at Atlas Antibodies

Documents & Links for Anti STOX2 pAb (ATL-HPA049776)
Datasheet Anti STOX2 pAb (ATL-HPA049776) Datasheet (External Link)
Vendor Page Anti STOX2 pAb (ATL-HPA049776)