Anti STK32B pAb (ATL-HPA058536)

Atlas Antibodies

SKU: ATL-HPA058536-25

• 

Protein Description: serine/threonine kinase 32B
Gene Name: STK32B
Alternative Gene Name: HSA250839, STK32, STKG6, YANK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029123: 86%, ENSRNOG00000031397: 84%
Entrez Gene ID: 55351
Uniprot ID: Q9NY57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV
• Gene Sequence: LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV
• Gene ID - Mouse: ENSMUSG00000029123
• Gene ID - Rat: ENSRNOG00000031397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.