Anti STK26 pAb (ATL-HPA059921)

Atlas Antibodies

SKU:
ATL-HPA059921-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: serine/threonine protein kinase 26
Gene Name: STK26
Alternative Gene Name: MASK, MST4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031112: 92%, ENSRNOG00000007879: 93%
Entrez Gene ID: 51765
Uniprot ID: Q9P289
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNA
Gene Sequence GHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNA
Gene ID - Mouse ENSMUSG00000031112
Gene ID - Rat ENSRNOG00000007879
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti STK26 pAb (ATL-HPA059921)
Datasheet Anti STK26 pAb (ATL-HPA059921) Datasheet (External Link)
Vendor Page Anti STK26 pAb (ATL-HPA059921) at Atlas Antibodies

Documents & Links for Anti STK26 pAb (ATL-HPA059921)
Datasheet Anti STK26 pAb (ATL-HPA059921) Datasheet (External Link)
Vendor Page Anti STK26 pAb (ATL-HPA059921)