Anti STK11 pAb (ATL-HPA017254)

Atlas Antibodies

Catalog No.: ATL-HPA017254-25

Protein Description: serine/threonine kinase 11
Gene Name: STK11
Alternative Gene Name: LKB1, PJS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003068: 99%, ENSRNOG00000014287: 99%
Entrez Gene ID: 6794
Uniprot ID: Q15831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ
• Gene Sequence: DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ
• Gene ID - Mouse: ENSMUSG00000003068
• Gene ID - Rat: ENSRNOG00000014287
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STK11 pAb (ATL-HPA017254) – 2 Found

Co, Ngai Na; Iglesias, David; Celestino, Joseph; Kwan, Suet Y; Mok, Samuel C; Schmandt, Rosemarie; Lu, Karen H. Loss of LKB1 in high-grade endometrial carcinoma: LKB1 is a novel transcriptional target of p53. Cancer. 2014;120(22):3457-68. 

Avilés-Salas, Alejandro; Díaz-García, Diego A; Lara-Mejía, Luis; Cardona, Andrés F; Orozco-Morales, Mario; Catalán, Rodrigo; Hernández-Pedro, Norma Y; Rios-Garcia, Eduardo; Ramos-Ramírez, Maritza; Arrieta, Oscar. LKB1 Loss Assessed by Immunohistochemistry as a Prognostic Marker to First-Line Therapy in Advanced Non-Small-Cell Lung Cancer. Current Oncology (Toronto, Ont.). 2022;30(1):333-343.