Anti STK11 pAb (ATL-HPA017254)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017254-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: STK11
Alternative Gene Name: LKB1, PJS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003068: 99%, ENSRNOG00000014287: 99%
Entrez Gene ID: 6794
Uniprot ID: Q15831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ |
| Gene Sequence | DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ |
| Gene ID - Mouse | ENSMUSG00000003068 |
| Gene ID - Rat | ENSRNOG00000014287 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STK11 pAb (ATL-HPA017254) | |
| Datasheet | Anti STK11 pAb (ATL-HPA017254) Datasheet (External Link) |
| Vendor Page | Anti STK11 pAb (ATL-HPA017254) at Atlas Antibodies |
| Documents & Links for Anti STK11 pAb (ATL-HPA017254) | |
| Datasheet | Anti STK11 pAb (ATL-HPA017254) Datasheet (External Link) |
| Vendor Page | Anti STK11 pAb (ATL-HPA017254) |
| Citations for Anti STK11 pAb (ATL-HPA017254) – 2 Found |
| Co, Ngai Na; Iglesias, David; Celestino, Joseph; Kwan, Suet Y; Mok, Samuel C; Schmandt, Rosemarie; Lu, Karen H. Loss of LKB1 in high-grade endometrial carcinoma: LKB1 is a novel transcriptional target of p53. Cancer. 2014;120(22):3457-68. PubMed |
| Avilés-Salas, Alejandro; Díaz-García, Diego A; Lara-Mejía, Luis; Cardona, Andrés F; Orozco-Morales, Mario; Catalán, Rodrigo; Hernández-Pedro, Norma Y; Rios-Garcia, Eduardo; Ramos-Ramírez, Maritza; Arrieta, Oscar. LKB1 Loss Assessed by Immunohistochemistry as a Prognostic Marker to First-Line Therapy in Advanced Non-Small-Cell Lung Cancer. Current Oncology (Toronto, Ont.). 2022;30(1):333-343. PubMed |