Anti STEAP3 pAb (ATL-HPA050510 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050510-100
  • Immunohistochemical staining of human Liver shows strong membranous and cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
  • Western blot analysis in human cell line PC-3 and human cell line SK-MEL-30.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: STEAP family member 3, metalloreductase
Gene Name: STEAP3
Alternative Gene Name: dudlin-2, STMP3, TSAP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026389: 93%, ENSRNOG00000049471: 91%
Entrez Gene ID: 55240
Uniprot ID: Q658P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRE
Gene Sequence PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRE
Gene ID - Mouse ENSMUSG00000026389
Gene ID - Rat ENSRNOG00000049471
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti STEAP3 pAb (ATL-HPA050510 w/enhanced validation)
Datasheet Anti STEAP3 pAb (ATL-HPA050510 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STEAP3 pAb (ATL-HPA050510 w/enhanced validation)



Citations for Anti STEAP3 pAb (ATL-HPA050510 w/enhanced validation) – 1 Found
Kubota, Shigehisa; Yoshida, Tetsuya; Kageyama, Susumu; Isono, Takahiro; Yuasa, Takeshi; Yonese, Junji; Kushima, Ryoji; Kawauchi, Akihiro; Chano, Tokuhiro. A risk stratification model based on four novel biomarkers predicts prognosis for patients with renal cell carcinoma. World Journal Of Surgical Oncology. 2020;18(1):270.  PubMed