Anti STC2 pAb (ATL-HPA045372 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA045372-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: STC2
Alternative Gene Name: STC-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020303: 72%, ENSRNOG00000020729: 68%
Entrez Gene ID: 8614
Uniprot ID: O76061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR |
Gene Sequence | SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR |
Gene ID - Mouse | ENSMUSG00000020303 |
Gene ID - Rat | ENSRNOG00000020729 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) | |
Datasheet | Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) | |
Datasheet | Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) |
Citations for Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) – 4 Found |
Jansen, Maurice P H M; Sas, Leen; Sieuwerts, Anieta M; Van Cauwenberghe, Caroline; Ramirez-Ardila, Diana; Look, Maxime; Ruigrok-Ritstier, Kirsten; Finetti, Pascal; Bertucci, François; Timmermans, Mieke M; van Deurzen, Carolien H M; Martens, John W M; Simon, Iris; Roepman, Paul; Linn, Sabine C; van Dam, Peter; Kok, Marleen; Lardon, Filip; Vermeulen, Peter B; Foekens, John A; Dirix, Luc; Berns, Els M J J; Van Laere, Steven. Decreased expression of ABAT and STC2 hallmarks ER-positive inflammatory breast cancer and endocrine therapy resistance in advanced disease. Molecular Oncology. 2015;9(6):1218-33. PubMed |
Brantley, Kristen D; Kjærsgaard, Anders; Cronin-Fenton, Deirdre; Yacoub, Rami; Nielsen, Anja S; Lauridsen, Kristina L; Hamilton-Dutoit, Stephen; Lash, Timothy L. Stanniocalcin Expression as a Predictor of Late Breast Cancer Recurrence. Cancer Epidemiology, Biomarkers & Prevention : A Publication Of The American Association For Cancer Research, Cosponsored By The American Society Of Preventive Oncology. 2018;27(6):653-659. PubMed |
Coulson-Gilmer, Camilla; Humphries, Matthew P; Sundara Rajan, Sreekumar; Droop, Alastair; Jackson, Sharon; Condon, Alexandra; Cserni, Gabor; Jordan, Lee B; Jones, Louise J; Kanthan, Rani; Di Benedetto, Anna; Mottolese, Marcella; Provenzano, Elena; Kulka, Janina; Shaaban, Abeer M; Hanby, Andrew M; Speirs, Valerie. Stanniocalcin 2 expression is associated with a favourable outcome in male breast cancer. The Journal Of Pathology. Clinical Research. 2018;4(4):241-249. PubMed |
Persson Skare, Tor; Kaito, Hiroshi; Durall, Claudia; Aastrup, Teodor; Claesson-Welsh, Lena. Quartz Crystal Microbalance Measurement of Histidine-Rich Glycoprotein and Stanniocalcin-2 Binding to Each Other and to Inflammatory Cells. Cells. 2022;11(17) PubMed |