Anti STC2 pAb (ATL-HPA045372 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045372-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
  • Western blot analysis in human cell line TD47D.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: stanniocalcin 2
Gene Name: STC2
Alternative Gene Name: STC-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020303: 72%, ENSRNOG00000020729: 68%
Entrez Gene ID: 8614
Uniprot ID: O76061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR
Gene Sequence SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR
Gene ID - Mouse ENSMUSG00000020303
Gene ID - Rat ENSRNOG00000020729
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti STC2 pAb (ATL-HPA045372 w/enhanced validation)
Datasheet Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti STC2 pAb (ATL-HPA045372 w/enhanced validation)
Datasheet Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STC2 pAb (ATL-HPA045372 w/enhanced validation)



Citations for Anti STC2 pAb (ATL-HPA045372 w/enhanced validation) – 4 Found
Jansen, Maurice P H M; Sas, Leen; Sieuwerts, Anieta M; Van Cauwenberghe, Caroline; Ramirez-Ardila, Diana; Look, Maxime; Ruigrok-Ritstier, Kirsten; Finetti, Pascal; Bertucci, François; Timmermans, Mieke M; van Deurzen, Carolien H M; Martens, John W M; Simon, Iris; Roepman, Paul; Linn, Sabine C; van Dam, Peter; Kok, Marleen; Lardon, Filip; Vermeulen, Peter B; Foekens, John A; Dirix, Luc; Berns, Els M J J; Van Laere, Steven. Decreased expression of ABAT and STC2 hallmarks ER-positive inflammatory breast cancer and endocrine therapy resistance in advanced disease. Molecular Oncology. 2015;9(6):1218-33.  PubMed
Brantley, Kristen D; Kjærsgaard, Anders; Cronin-Fenton, Deirdre; Yacoub, Rami; Nielsen, Anja S; Lauridsen, Kristina L; Hamilton-Dutoit, Stephen; Lash, Timothy L. Stanniocalcin Expression as a Predictor of Late Breast Cancer Recurrence. Cancer Epidemiology, Biomarkers & Prevention : A Publication Of The American Association For Cancer Research, Cosponsored By The American Society Of Preventive Oncology. 2018;27(6):653-659.  PubMed
Coulson-Gilmer, Camilla; Humphries, Matthew P; Sundara Rajan, Sreekumar; Droop, Alastair; Jackson, Sharon; Condon, Alexandra; Cserni, Gabor; Jordan, Lee B; Jones, Louise J; Kanthan, Rani; Di Benedetto, Anna; Mottolese, Marcella; Provenzano, Elena; Kulka, Janina; Shaaban, Abeer M; Hanby, Andrew M; Speirs, Valerie. Stanniocalcin 2 expression is associated with a favourable outcome in male breast cancer. The Journal Of Pathology. Clinical Research. 2018;4(4):241-249.  PubMed
Persson Skare, Tor; Kaito, Hiroshi; Durall, Claudia; Aastrup, Teodor; Claesson-Welsh, Lena. Quartz Crystal Microbalance Measurement of Histidine-Rich Glycoprotein and Stanniocalcin-2 Binding to Each Other and to Inflammatory Cells. Cells. 2022;11(17)  PubMed