Anti STAU1 pAb (ATL-HPA049892)

Atlas Antibodies

SKU: ATL-HPA049892-25

• 
• 

Protein Description: staufen double-stranded RNA binding protein 1
Gene Name: STAU1
Alternative Gene Name: PPP1R150, STAU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039536: 93%, ENSRNOG00000007781: 93%
Entrez Gene ID: 6780
Uniprot ID: O95793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG
• Gene Sequence: TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG
• Gene ID - Mouse: ENSMUSG00000039536
• Gene ID - Rat: ENSRNOG00000007781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.