Anti STAT5A pAb (ATL-HPA049883)
Atlas Antibodies
- SKU:
- ATL-HPA049883-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: STAT5A
Alternative Gene Name: MGF, STAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020919: 100%, ENSRNOG00000019496: 100%
Entrez Gene ID: 6776
Uniprot ID: P42229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRN |
Gene Sequence | KTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRN |
Gene ID - Mouse | ENSMUSG00000020919 |
Gene ID - Rat | ENSRNOG00000019496 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti STAT5A pAb (ATL-HPA049883) | |
Datasheet | Anti STAT5A pAb (ATL-HPA049883) Datasheet (External Link) |
Vendor Page | Anti STAT5A pAb (ATL-HPA049883) at Atlas Antibodies |
Documents & Links for Anti STAT5A pAb (ATL-HPA049883) | |
Datasheet | Anti STAT5A pAb (ATL-HPA049883) Datasheet (External Link) |
Vendor Page | Anti STAT5A pAb (ATL-HPA049883) |