Anti STARD4 pAb (ATL-HPA046177)

Atlas Antibodies

Catalog No.:
ATL-HPA046177-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: StAR-related lipid transfer (START) domain containing 4
Gene Name: STARD4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024378: 85%, ENSRNOG00000020468: 86%
Entrez Gene ID: 134429
Uniprot ID: Q96DR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGP
Gene Sequence MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGP
Gene ID - Mouse ENSMUSG00000024378
Gene ID - Rat ENSRNOG00000020468
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STARD4 pAb (ATL-HPA046177)
Datasheet Anti STARD4 pAb (ATL-HPA046177) Datasheet (External Link)
Vendor Page Anti STARD4 pAb (ATL-HPA046177) at Atlas Antibodies

Documents & Links for Anti STARD4 pAb (ATL-HPA046177)
Datasheet Anti STARD4 pAb (ATL-HPA046177) Datasheet (External Link)
Vendor Page Anti STARD4 pAb (ATL-HPA046177)