Anti STAG3 pAb (ATL-HPA058330 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA058330-25

• 

Product Description

Protein Description: stromal antigen 3
Gene Name: STAG3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036928: 73%, ENSRNOG00000001360: 71%
Entrez Gene ID: 10734
Uniprot ID: Q9UJ98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFHQDKQLLLSYLEKCLQHVSQAPGHPWGPVTTYCHSLSPVENTAETSPQVLPSSKRRRVEGPAKPNREDVSS
• Gene Sequence: LFHQDKQLLLSYLEKCLQHVSQAPGHPWGPVTTYCHSLSPVENTAETSPQVLPSSKRRRVEGPAKPNREDVSS
• Gene ID - Mouse: ENSMUSG00000036928
• Gene ID - Rat: ENSRNOG00000001360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links