Anti STAG1 pAb (ATL-HPA058653)

Atlas Antibodies

SKU:
ATL-HPA058653-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: stromal antigen 1
Gene Name: STAG1
Alternative Gene Name: SA-1, SA1, SCC3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037286: 96%, ENSRNOG00000015389: 94%
Entrez Gene ID: 10274
Uniprot ID: Q8WVM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLT
Gene Sequence RNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLT
Gene ID - Mouse ENSMUSG00000037286
Gene ID - Rat ENSRNOG00000015389
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti STAG1 pAb (ATL-HPA058653)
Datasheet Anti STAG1 pAb (ATL-HPA058653) Datasheet (External Link)
Vendor Page Anti STAG1 pAb (ATL-HPA058653) at Atlas Antibodies

Documents & Links for Anti STAG1 pAb (ATL-HPA058653)
Datasheet Anti STAG1 pAb (ATL-HPA058653) Datasheet (External Link)
Vendor Page Anti STAG1 pAb (ATL-HPA058653)