Protein Description: suppression of tumorigenicity 7 like
Gene Name: ST7L
Alternative Gene Name: FAM4B, FLJ20284, ST7R, STLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024353: 29%, ENSRNOG00000022009: 29%
Entrez Gene ID: 54879
Uniprot ID: Q8TDW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ST7L
Alternative Gene Name: FAM4B, FLJ20284, ST7R, STLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024353: 29%, ENSRNOG00000022009: 29%
Entrez Gene ID: 54879
Uniprot ID: Q8TDW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HQFPEIMGIFAKAVLGLWCPQPWASSGFEENTQDLKSEDLGLSSG |
| Documents & Links for Anti ST7L pAb (ATL-HPA075418) | |
| Datasheet | Anti ST7L pAb (ATL-HPA075418) Datasheet (External Link) |
| Vendor Page | Anti ST7L pAb (ATL-HPA075418) at Atlas |
| Documents & Links for Anti ST7L pAb (ATL-HPA075418) | |
| Datasheet | Anti ST7L pAb (ATL-HPA075418) Datasheet (External Link) |
| Vendor Page | Anti ST7L pAb (ATL-HPA075418) |