Anti ST6GALNAC5 pAb (ATL-HPA070354)

Atlas Antibodies

SKU: ATL-HPA070354-25

• 

Product Description

Protein Description: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
Gene Name: ST6GALNAC5
Alternative Gene Name: MGC3184, SIAT7E, ST6GalNAcV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039037: 96%, ENSRNOG00000049676: 97%
Entrez Gene ID: 81849
Uniprot ID: Q9BVH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVYNNLHLLSQVLP
• Gene Sequence: GYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVYNNLHLLSQVLP
• Gene ID - Mouse: ENSMUSG00000039037
• Gene ID - Rat: ENSRNOG00000049676
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links