Protein Description: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
Gene Name: ST6GALNAC5
Alternative Gene Name: MGC3184, SIAT7E, ST6GalNAcV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039037: 96%, ENSRNOG00000049676: 97%
Entrez Gene ID: 81849
Uniprot ID: Q9BVH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ST6GALNAC5
Alternative Gene Name: MGC3184, SIAT7E, ST6GalNAcV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039037: 96%, ENSRNOG00000049676: 97%
Entrez Gene ID: 81849
Uniprot ID: Q9BVH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVYNNLHLLSQVLP |
| Documents & Links for Anti ST6GALNAC5 pAb (ATL-HPA070354) | |
| Datasheet | Anti ST6GALNAC5 pAb (ATL-HPA070354) Datasheet (External Link) |
| Vendor Page | Anti ST6GALNAC5 pAb (ATL-HPA070354) at Atlas |
| Documents & Links for Anti ST6GALNAC5 pAb (ATL-HPA070354) | |
| Datasheet | Anti ST6GALNAC5 pAb (ATL-HPA070354) Datasheet (External Link) |
| Vendor Page | Anti ST6GALNAC5 pAb (ATL-HPA070354) |