Anti ST3GAL4 pAb (ATL-HPA049827)

Atlas Antibodies

SKU: ATL-HPA049827-25

• 

Protein Description: ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Name: ST3GAL4
Alternative Gene Name: CGS23, FLJ11867, NANTA3, SAT3, SIAT4, SIAT4C, STZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032038: 82%, ENSRNOG00000009850: 82%
Entrez Gene ID: 6484
Uniprot ID: Q11206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYE
• Gene Sequence: SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYE
• Gene ID - Mouse: ENSMUSG00000032038
• Gene ID - Rat: ENSRNOG00000009850
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.