Anti ST14 pAb (ATL-HPA047014)

Atlas Antibodies

SKU: ATL-HPA047014-25

• 

Protein Description: suppression of tumorigenicity 14 (colon carcinoma)
Gene Name: ST14
Alternative Gene Name: HAI, MT-SP1, PRSS14, SNC19, TMPRSS14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031995: 82%, ENSRNOG00000005903: 82%
Entrez Gene ID: 6768
Uniprot ID: Q9Y5Y6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE
• Gene Sequence: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE
• Gene ID - Mouse: ENSMUSG00000031995
• Gene ID - Rat: ENSRNOG00000005903
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.