Anti ST13 pAb (ATL-HPA047116 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047116-100

• 
• 

Protein Description: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
Gene Name: ST13
Alternative Gene Name: FAM10A1, HIP, HSPABP1, P48, SNC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022403: 99%, ENSRNOG00000019070: 97%
Entrez Gene ID: 6767
Uniprot ID: P50502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER
• Gene Sequence: AIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER
• Gene ID - Mouse: ENSMUSG00000022403
• Gene ID - Rat: ENSRNOG00000019070
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.