Anti ST13 pAb (ATL-HPA046412 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046412-100
  • Immunohistochemical staining of human colon, kidney, ovary and testis using Anti-ST13 antibody HPA046412 (A) shows similar protein distribution across tissues to independent antibody HPA043233 (B).
  • Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
  • Western blot analysis using Anti-ST13 antibody HPA046412 (A) shows similar pattern to independent antibody HPA047114 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
Gene Name: ST13
Alternative Gene Name: FAM10A1, HIP, HSPABP1, P48, SNC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022403: 95%, ENSRNOG00000019070: 94%
Entrez Gene ID: 6767
Uniprot ID: P50502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA
Gene Sequence PGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA
Gene ID - Mouse ENSMUSG00000022403
Gene ID - Rat ENSRNOG00000019070
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ST13 pAb (ATL-HPA046412 w/enhanced validation)
Datasheet Anti ST13 pAb (ATL-HPA046412 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ST13 pAb (ATL-HPA046412 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ST13 pAb (ATL-HPA046412 w/enhanced validation)
Datasheet Anti ST13 pAb (ATL-HPA046412 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ST13 pAb (ATL-HPA046412 w/enhanced validation)