Anti SS18L2 pAb (ATL-HPA047377)

Atlas Antibodies

SKU: ATL-HPA047377-25

• 
• 

Protein Description: synovial sarcoma translocation gene on chromosome 18-like 2
Gene Name: SS18L2
Alternative Gene Name: KIAA-iso
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032526: 92%, ENSRNOG00000047853: 92%
Entrez Gene ID: 51188
Uniprot ID: Q9UHA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLH
• Gene Sequence: VAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLH
• Gene ID - Mouse: ENSMUSG00000032526
• Gene ID - Rat: ENSRNOG00000047853
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.