Anti SRSF2 pAb (ATL-HPA049905)

Atlas Antibodies

SKU: ATL-HPA049905-100

• 
• 
• 

Protein Description: serine/arginine-rich splicing factor 2
Gene Name: SRSF2
Alternative Gene Name: PR264, SC-35, SC35, SFRS2, SFRS2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034120: 97%, ENSRNOG00000000248: 97%
Entrez Gene ID: 6427
Uniprot ID: Q01130
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR
• Gene Sequence: LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR
• Gene ID - Mouse: ENSMUSG00000034120
• Gene ID - Rat: ENSRNOG00000000248
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SRSF2 pAb (ATL-HPA049905) – 2 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. 

Guantes, Raul; Rastrojo, Alberto; Neves, Ricardo; Lima, Ana; Aguado, Begoña; Iborra, Francisco J. Global variability in gene expression and alternative splicing is modulated by mitochondrial content. Genome Research. 2015;25(5):633-44.