Anti SRSF10 pAb (ATL-HPA053831)

Atlas Antibodies

SKU: ATL-HPA053831-25

• 
• 

Protein Description: serine/arginine-rich splicing factor 10
Gene Name: SRSF10
Alternative Gene Name: FUSIP1, FUSIP2, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR1, TASR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028676: 100%, ENSRNOG00000010007: 41%
Entrez Gene ID: 10772
Uniprot ID: O75494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS
• Gene Sequence: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS
• Gene ID - Mouse: ENSMUSG00000028676
• Gene ID - Rat: ENSRNOG00000010007
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SRSF10 pAb (ATL-HPA053831) – 2 Found

Bhatta, Bibek; Luz, Ishai; Krueger, Christian; Teo, Fanny Xueting; Lane, David P; Sabapathy, Kanaga; Cooks, Tomer. Cancer Cells Shuttle Extracellular Vesicles Containing Oncogenic Mutant p53 Proteins to the Tumor Microenvironment. Cancers. 2021;13(12) 

Yadav, Sandhya; Pant, Deepak; Samaiya, Atul; Kalra, Neetu; Gupta, Sanjay; Shukla, Sanjeev. ERK1/2-EGR1-SRSF10 Axis Mediated Alternative Splicing Plays a Critical Role in Head and Neck Cancer. Frontiers In Cell And Developmental Biology. 9( 34616729):713661.