Anti SPSB3 pAb (ATL-HPA046602)

Atlas Antibodies

SKU:
ATL-HPA046602-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line HeLa shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: splA/ryanodine receptor domain and SOCS box containing 3
Gene Name: SPSB3
Alternative Gene Name: C16orf31, SSB-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024160: 97%, ENSRNOG00000015300: 97%
Entrez Gene ID: 90864
Uniprot ID: Q6PJ21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVC
Gene Sequence KVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVC
Gene ID - Mouse ENSMUSG00000024160
Gene ID - Rat ENSRNOG00000015300
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPSB3 pAb (ATL-HPA046602)
Datasheet Anti SPSB3 pAb (ATL-HPA046602) Datasheet (External Link)
Vendor Page Anti SPSB3 pAb (ATL-HPA046602) at Atlas Antibodies

Documents & Links for Anti SPSB3 pAb (ATL-HPA046602)
Datasheet Anti SPSB3 pAb (ATL-HPA046602) Datasheet (External Link)
Vendor Page Anti SPSB3 pAb (ATL-HPA046602)