Anti SPRYD4 pAb (ATL-HPA053469)

Atlas Antibodies

SKU:
ATL-HPA053469-100
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: SPRY domain containing 4
Gene Name: SPRYD4
Alternative Gene Name: DKFZp686N0877
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051346: 81%, ENSRNOG00000003127: 81%
Entrez Gene ID: 283377
Uniprot ID: Q8WW59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDTGVKYGLVGLEPTKVALNVERFREWAVVLADTAVTSGRHY
Gene Sequence FARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDTGVKYGLVGLEPTKVALNVERFREWAVVLADTAVTSGRHY
Gene ID - Mouse ENSMUSG00000051346
Gene ID - Rat ENSRNOG00000003127
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPRYD4 pAb (ATL-HPA053469)
Datasheet Anti SPRYD4 pAb (ATL-HPA053469) Datasheet (External Link)
Vendor Page Anti SPRYD4 pAb (ATL-HPA053469) at Atlas Antibodies

Documents & Links for Anti SPRYD4 pAb (ATL-HPA053469)
Datasheet Anti SPRYD4 pAb (ATL-HPA053469) Datasheet (External Link)
Vendor Page Anti SPRYD4 pAb (ATL-HPA053469)