Anti SPRYD4 pAb (ATL-HPA053469)

Atlas Antibodies

SKU: ATL-HPA053469-100

• 
• 
• 

Protein Description: SPRY domain containing 4
Gene Name: SPRYD4
Alternative Gene Name: DKFZp686N0877
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051346: 81%, ENSRNOG00000003127: 81%
Entrez Gene ID: 283377
Uniprot ID: Q8WW59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDTGVKYGLVGLEPTKVALNVERFREWAVVLADTAVTSGRHY
• Gene Sequence: FARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDTGVKYGLVGLEPTKVALNVERFREWAVVLADTAVTSGRHY
• Gene ID - Mouse: ENSMUSG00000051346
• Gene ID - Rat: ENSRNOG00000003127
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.