Anti SPN pAb (ATL-HPA055244 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA055244-25
  • Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-SPN antibody. Corresponding SPN RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: sialophorin
Gene Name: SPN
Alternative Gene Name: CD43, GPL115, LSN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051457: 65%, ENSRNOG00000036711: 65%
Entrez Gene ID: 6693
Uniprot ID: P16150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEG
Gene Sequence VTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEG
Gene ID - Mouse ENSMUSG00000051457
Gene ID - Rat ENSRNOG00000036711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPN pAb (ATL-HPA055244 w/enhanced validation)
Datasheet Anti SPN pAb (ATL-HPA055244 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPN pAb (ATL-HPA055244 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SPN pAb (ATL-HPA055244 w/enhanced validation)
Datasheet Anti SPN pAb (ATL-HPA055244 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPN pAb (ATL-HPA055244 w/enhanced validation)