Anti SPIRE2 pAb (ATL-HPA049415)

Atlas Antibodies

SKU:
ATL-HPA049415-25
  • Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: spire-type actin nucleation factor 2
Gene Name: SPIRE2
Alternative Gene Name: KIAA1832, spir-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010154: 83%, ENSRNOG00000016920: 81%
Entrez Gene ID: 84501
Uniprot ID: Q8WWL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HIPVYTLGFESPQRVSAAKTAPIQRRDIFQSLQGPQWQSVEEAFPHIYSHGCVLKDVCSECTSFVADVVRSSRKSVDVLNTTPRRSRQTQSLYIPNTRTLD
Gene Sequence HIPVYTLGFESPQRVSAAKTAPIQRRDIFQSLQGPQWQSVEEAFPHIYSHGCVLKDVCSECTSFVADVVRSSRKSVDVLNTTPRRSRQTQSLYIPNTRTLD
Gene ID - Mouse ENSMUSG00000010154
Gene ID - Rat ENSRNOG00000016920
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPIRE2 pAb (ATL-HPA049415)
Datasheet Anti SPIRE2 pAb (ATL-HPA049415) Datasheet (External Link)
Vendor Page Anti SPIRE2 pAb (ATL-HPA049415) at Atlas Antibodies

Documents & Links for Anti SPIRE2 pAb (ATL-HPA049415)
Datasheet Anti SPIRE2 pAb (ATL-HPA049415) Datasheet (External Link)
Vendor Page Anti SPIRE2 pAb (ATL-HPA049415)