Anti SPINT4 pAb (ATL-HPA046703 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046703-25

• 

Protein Description: serine peptidase inhibitor, Kunitz type 4
Gene Name: SPINT4
Alternative Gene Name: C20orf137, dJ601O1.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017310: 68%, ENSRNOG00000014794: 64%
Entrez Gene ID: 391253
Uniprot ID: Q6UDR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLK
• Gene Sequence: KICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLK
• Gene ID - Mouse: ENSMUSG00000017310
• Gene ID - Rat: ENSRNOG00000014794
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.