Anti SPINK8 pAb (ATL-HPA053151)

Atlas Antibodies

SKU:
ATL-HPA053151-25
  • Immunohistochemical staining of human bronchus shows strong dot-like cytoplasmic and membranous positivity in respiratory epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: serine peptidase inhibitor, Kazal type 8 (putative)
Gene Name: SPINK8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050074: 51%, ENSRNOG00000037199: 53%
Entrez Gene ID: 646424
Uniprot ID: P0C7L1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPMASERGQLDKTIVECLKNVNKCWFLSYIKPSEPICGSDQVTYSSDCHLCSKILFEGLNITKLYDGQCE
Gene Sequence LPMASERGQLDKTIVECLKNVNKCWFLSYIKPSEPICGSDQVTYSSDCHLCSKILFEGLNITKLYDGQCE
Gene ID - Mouse ENSMUSG00000050074
Gene ID - Rat ENSRNOG00000037199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPINK8 pAb (ATL-HPA053151)
Datasheet Anti SPINK8 pAb (ATL-HPA053151) Datasheet (External Link)
Vendor Page Anti SPINK8 pAb (ATL-HPA053151) at Atlas Antibodies

Documents & Links for Anti SPINK8 pAb (ATL-HPA053151)
Datasheet Anti SPINK8 pAb (ATL-HPA053151) Datasheet (External Link)
Vendor Page Anti SPINK8 pAb (ATL-HPA053151)