Anti SPINK8 pAb (ATL-HPA053151)
Atlas Antibodies
- SKU:
- ATL-HPA053151-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SPINK8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050074: 51%, ENSRNOG00000037199: 53%
Entrez Gene ID: 646424
Uniprot ID: P0C7L1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPMASERGQLDKTIVECLKNVNKCWFLSYIKPSEPICGSDQVTYSSDCHLCSKILFEGLNITKLYDGQCE |
Gene Sequence | LPMASERGQLDKTIVECLKNVNKCWFLSYIKPSEPICGSDQVTYSSDCHLCSKILFEGLNITKLYDGQCE |
Gene ID - Mouse | ENSMUSG00000050074 |
Gene ID - Rat | ENSRNOG00000037199 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SPINK8 pAb (ATL-HPA053151) | |
Datasheet | Anti SPINK8 pAb (ATL-HPA053151) Datasheet (External Link) |
Vendor Page | Anti SPINK8 pAb (ATL-HPA053151) at Atlas Antibodies |
Documents & Links for Anti SPINK8 pAb (ATL-HPA053151) | |
Datasheet | Anti SPINK8 pAb (ATL-HPA053151) Datasheet (External Link) |
Vendor Page | Anti SPINK8 pAb (ATL-HPA053151) |