Protein Description: spindlin 1
Gene Name: SPIN1
Alternative Gene Name: SPIN, TDRD24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021395: 98%, ENSRNOG00000011119: 98%
Entrez Gene ID: 10927
Uniprot ID: Q9Y657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPIN1
Alternative Gene Name: SPIN, TDRD24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021395: 98%, ENSRNOG00000011119: 98%
Entrez Gene ID: 10927
Uniprot ID: Q9Y657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNI |
Documents & Links for Anti SPIN1 pAb (ATL-HPA068784) | |
Datasheet | Anti SPIN1 pAb (ATL-HPA068784) Datasheet (External Link) |
Vendor Page | Anti SPIN1 pAb (ATL-HPA068784) at Atlas |
Documents & Links for Anti SPIN1 pAb (ATL-HPA068784) | |
Datasheet | Anti SPIN1 pAb (ATL-HPA068784) Datasheet (External Link) |
Vendor Page | Anti SPIN1 pAb (ATL-HPA068784) |