Protein Description: spindle and centriole associated protein 1
Gene Name: SPICE1
Alternative Gene Name: CCDC52, SPICE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043065: 75%, ENSRNOG00000039024: 71%
Entrez Gene ID: 152185
Uniprot ID: Q8N0Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPICE1
Alternative Gene Name: CCDC52, SPICE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043065: 75%, ENSRNOG00000039024: 71%
Entrez Gene ID: 152185
Uniprot ID: Q8N0Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DEQLISLTHAIKNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVP |
Documents & Links for Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) | |
Datasheet | Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) at Atlas |
Documents & Links for Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) | |
Datasheet | Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) |
Citations for Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) – 3 Found |
Deretic, Jovana; Kerr, Alastair; Welburn, Julie P I. A rapid computational approach identifies SPICE1 as an Aurora kinase substrate. Molecular Biology Of The Cell. 2019;30(3):312-323. PubMed |
Sydor, Andrew Michael; Coyaud, Etienne; Rovelli, Cristina; Laurent, Estelle; Liu, Helen; Raught, Brian; Mennella, Vito. PPP1R35 is a novel centrosomal protein that regulates centriole length in concert with the microcephaly protein RTTN. Elife. 2018;7( 30168418) PubMed |
Balestra, Fernando R; Domínguez-Calvo, Andrés; Wolf, Benita; Busso, Coralie; Buff, Alizée; Averink, Tessa; Lipsanen-Nyman, Marita; Huertas, Pablo; Ríos, Rosa M; Gönczy, Pierre. TRIM37 prevents formation of centriolar protein assemblies by regulating Centrobin. Elife. 2021;10( 33491649) PubMed |