Protein Description: sphingosine kinase 2
Gene Name: SPHK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057342: 86%, ENSRNOG00000021032: 86%
Entrez Gene ID: 56848
Uniprot ID: Q9NRA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPHK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057342: 86%, ENSRNOG00000021032: 86%
Entrez Gene ID: 56848
Uniprot ID: Q9NRA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LTCLLRGLPLPGDGEITPDLLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHA |
Documents & Links for Anti SPHK2 pAb (ATL-HPA065508) | |
Datasheet | Anti SPHK2 pAb (ATL-HPA065508) Datasheet (External Link) |
Vendor Page | Anti SPHK2 pAb (ATL-HPA065508) at Atlas |
Documents & Links for Anti SPHK2 pAb (ATL-HPA065508) | |
Datasheet | Anti SPHK2 pAb (ATL-HPA065508) Datasheet (External Link) |
Vendor Page | Anti SPHK2 pAb (ATL-HPA065508) |