Anti SPESP1 pAb (ATL-HPA045936 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045936-25

• 
• 

Protein Description: sperm equatorial segment protein 1
Gene Name: SPESP1
Alternative Gene Name: SP-ESP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046846: 44%, ENSRNOG00000025359: 41%
Entrez Gene ID: 246777
Uniprot ID: Q6UW49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNSPKHVYSIASKGSKFKELVTHGDASTENDVLTNPISEETTTFPTG
• Gene Sequence: YPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNSPKHVYSIASKGSKFKELVTHGDASTENDVLTNPISEETTTFPTG
• Gene ID - Mouse: ENSMUSG00000046846
• Gene ID - Rat: ENSRNOG00000025359
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPESP1 pAb (ATL-HPA045936 w/enhanced validation) – 1 Found

Enoiu, Simona Ioana; Nygaard, Marie Berg; Bungum, Mona; Ziebe, Søren; Petersen, Morten Rønn; Almstrup, Kristian. Expression of membrane fusion proteins in spermatozoa and total fertilisation failure during in vitro fertilisation. Andrology. 2022;10(7):1317-1327.