Anti SPEN pAb (ATL-HPA050257)

Atlas Antibodies

SKU:
ATL-HPA050257-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: spen family transcriptional repressor
Gene Name: SPEN
Alternative Gene Name: KIAA0929, MINT, RBM15C, SHARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040761: 78%, ENSRNOG00000033556: 82%
Entrez Gene ID: 23013
Uniprot ID: Q96T58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEAVENQEVQSKKPIPSKPQLKQLQVLDDQGPEREDVRKNYCSLRDETPERKSGQEKSHSVNTEEKIGIDIDHTQSYRKQMEQSRRKQQMEMEIAKSEKFGSPKKDVDEYERRSLVHEVGKPPQDVTDDSPPSK
Gene Sequence GEAVENQEVQSKKPIPSKPQLKQLQVLDDQGPEREDVRKNYCSLRDETPERKSGQEKSHSVNTEEKIGIDIDHTQSYRKQMEQSRRKQQMEMEIAKSEKFGSPKKDVDEYERRSLVHEVGKPPQDVTDDSPPSK
Gene ID - Mouse ENSMUSG00000040761
Gene ID - Rat ENSRNOG00000033556
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPEN pAb (ATL-HPA050257)
Datasheet Anti SPEN pAb (ATL-HPA050257) Datasheet (External Link)
Vendor Page Anti SPEN pAb (ATL-HPA050257) at Atlas Antibodies

Documents & Links for Anti SPEN pAb (ATL-HPA050257)
Datasheet Anti SPEN pAb (ATL-HPA050257) Datasheet (External Link)
Vendor Page Anti SPEN pAb (ATL-HPA050257)