Anti SPDYE1 pAb (ATL-HPA051750)
Atlas Antibodies
- SKU:
- ATL-HPA051750-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: SPDYE1
Alternative Gene Name: Ringo1, SPDYE, WBSCR19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039296: 73%, ENSRNOG00000058563: 75%
Entrez Gene ID: 285955
Uniprot ID: Q8NFV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM |
Gene Sequence | SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM |
Gene ID - Mouse | ENSMUSG00000039296 |
Gene ID - Rat | ENSRNOG00000058563 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SPDYE1 pAb (ATL-HPA051750) | |
Datasheet | Anti SPDYE1 pAb (ATL-HPA051750) Datasheet (External Link) |
Vendor Page | Anti SPDYE1 pAb (ATL-HPA051750) at Atlas Antibodies |
Documents & Links for Anti SPDYE1 pAb (ATL-HPA051750) | |
Datasheet | Anti SPDYE1 pAb (ATL-HPA051750) Datasheet (External Link) |
Vendor Page | Anti SPDYE1 pAb (ATL-HPA051750) |