Anti SPDEF pAb (ATL-HPA055707)

Atlas Antibodies

SKU: ATL-HPA055707-25

• 

Protein Description: SAM pointed domain containing ETS transcription factor
Gene Name: SPDEF
Alternative Gene Name: bA375E1.3, PDEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024215: 79%, ENSRNOG00000000491: 79%
Entrez Gene ID: 25803
Uniprot ID: O95238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW
• Gene Sequence: QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW
• Gene ID - Mouse: ENSMUSG00000024215
• Gene ID - Rat: ENSRNOG00000000491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.