Anti SPC25 pAb (ATL-HPA047144)

Atlas Antibodies

SKU:
ATL-HPA047144-25
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Western blot analysis in human cell line U-2 OS.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SPC25, NDC80 kinetochore complex component
Gene Name: SPC25
Alternative Gene Name: AD024, MGC22228, SPBC25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005233: 78%, ENSRNOG00000006731: 83%
Entrez Gene ID: 57405
Uniprot ID: Q9HBM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVY
Gene Sequence RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVY
Gene ID - Mouse ENSMUSG00000005233
Gene ID - Rat ENSRNOG00000006731
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPC25 pAb (ATL-HPA047144)
Datasheet Anti SPC25 pAb (ATL-HPA047144) Datasheet (External Link)
Vendor Page Anti SPC25 pAb (ATL-HPA047144) at Atlas Antibodies

Documents & Links for Anti SPC25 pAb (ATL-HPA047144)
Datasheet Anti SPC25 pAb (ATL-HPA047144) Datasheet (External Link)
Vendor Page Anti SPC25 pAb (ATL-HPA047144)