Anti SPC24 pAb (ATL-HPA051234)

Atlas Antibodies

SKU:
ATL-HPA051234-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in subset of cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SPC24, NDC80 kinetochore complex component
Gene Name: SPC24
Alternative Gene Name: FLJ90806, SPBC24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074476: 85%, ENSRNOG00000029862: 91%
Entrez Gene ID: 147841
Uniprot ID: Q8NBT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLV
Gene Sequence ERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLV
Gene ID - Mouse ENSMUSG00000074476
Gene ID - Rat ENSRNOG00000029862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPC24 pAb (ATL-HPA051234)
Datasheet Anti SPC24 pAb (ATL-HPA051234) Datasheet (External Link)
Vendor Page Anti SPC24 pAb (ATL-HPA051234) at Atlas Antibodies

Documents & Links for Anti SPC24 pAb (ATL-HPA051234)
Datasheet Anti SPC24 pAb (ATL-HPA051234) Datasheet (External Link)
Vendor Page Anti SPC24 pAb (ATL-HPA051234)