Anti SPATS2L pAb (ATL-HPA055427)

Atlas Antibodies

SKU:
ATL-HPA055427-25
  • Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: spermatogenesis associated, serine-rich 2-like
Gene Name: SPATS2L
Alternative Gene Name: DNAPTP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038305: 85%, ENSRNOG00000016012: 86%
Entrez Gene ID: 26010
Uniprot ID: Q9NUQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPSKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWSAEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKR
Gene Sequence EPSKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWSAEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKR
Gene ID - Mouse ENSMUSG00000038305
Gene ID - Rat ENSRNOG00000016012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPATS2L pAb (ATL-HPA055427)
Datasheet Anti SPATS2L pAb (ATL-HPA055427) Datasheet (External Link)
Vendor Page Anti SPATS2L pAb (ATL-HPA055427) at Atlas Antibodies

Documents & Links for Anti SPATS2L pAb (ATL-HPA055427)
Datasheet Anti SPATS2L pAb (ATL-HPA055427) Datasheet (External Link)
Vendor Page Anti SPATS2L pAb (ATL-HPA055427)