Protein Description: spermatogenesis associated 9
Gene Name: SPATA9
Alternative Gene Name: FLJ35906, NYD-SP16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021590: 77%, ENSRNOG00000012770: 76%
Entrez Gene ID: 83890
Uniprot ID: Q9BWV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPATA9
Alternative Gene Name: FLJ35906, NYD-SP16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021590: 77%, ENSRNOG00000012770: 76%
Entrez Gene ID: 83890
Uniprot ID: Q9BWV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRG |
| Documents & Links for Anti SPATA9 pAb (ATL-HPA076967) | |
| Datasheet | Anti SPATA9 pAb (ATL-HPA076967) Datasheet (External Link) |
| Vendor Page | Anti SPATA9 pAb (ATL-HPA076967) at Atlas |
| Documents & Links for Anti SPATA9 pAb (ATL-HPA076967) | |
| Datasheet | Anti SPATA9 pAb (ATL-HPA076967) Datasheet (External Link) |
| Vendor Page | Anti SPATA9 pAb (ATL-HPA076967) |