Anti SPATA2 pAb (ATL-HPA052224)

Atlas Antibodies

SKU:
ATL-HPA052224-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: spermatogenesis associated 2
Gene Name: SPATA2
Alternative Gene Name: KIAA0757, PD1, PPP1R145, tamo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047030: 90%, ENSRNOG00000009207: 92%
Entrez Gene ID: 9825
Uniprot ID: Q9UM82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLRKEPVATDVGDDLKDEIIRPSPSLLTMASSPHGSPDVL
Gene Sequence KDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLRKEPVATDVGDDLKDEIIRPSPSLLTMASSPHGSPDVL
Gene ID - Mouse ENSMUSG00000047030
Gene ID - Rat ENSRNOG00000009207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPATA2 pAb (ATL-HPA052224)
Datasheet Anti SPATA2 pAb (ATL-HPA052224) Datasheet (External Link)
Vendor Page Anti SPATA2 pAb (ATL-HPA052224) at Atlas Antibodies

Documents & Links for Anti SPATA2 pAb (ATL-HPA052224)
Datasheet Anti SPATA2 pAb (ATL-HPA052224) Datasheet (External Link)
Vendor Page Anti SPATA2 pAb (ATL-HPA052224)