Anti SPATA2 pAb (ATL-HPA048581)

Atlas Antibodies

SKU: ATL-HPA048581-25

• 

Protein Description: spermatogenesis associated 2
Gene Name: SPATA2
Alternative Gene Name: KIAA0757, PD1, PPP1R145, tamo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047030: 88%, ENSRNOG00000009207: 85%
Entrez Gene ID: 9825
Uniprot ID: Q9UM82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPAS
• Gene Sequence: TYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPAS
• Gene ID - Mouse: ENSMUSG00000047030
• Gene ID - Rat: ENSRNOG00000009207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPATA2 pAb (ATL-HPA048581) – 2 Found

Wieser, Verena; Sprung, Susanne; Tsibulak, Irina; Haybaeck, Johannes; Hackl, Hubert; Fiegl, Heidelinde; Marth, Christian; Zeimet, Alain Gustave. Clinical Impact of RANK Signalling in Ovarian Cancer. Cancers. 2019;11(6) 

Wieser, Verena; Tsibulak, Irina; Degasper, Christine; Welponer, Hannah; Leitner, Katharina; Parson, Walther; Zeimet, Alain G; Marth, Christian; Fiegl, Heidelinde. Tumor necrosis factor receptor modulator spermatogenesis-associated protein 2 is a novel predictor of outcome in ovarian cancer. Cancer Science. 2019;110(3):1117-1126.