Protein Description: sperm associated antigen 8
Gene Name: SPAG8
Alternative Gene Name: BS-84, CILD28, CT142, HSD-1, hSMP-1, SPAG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066196: 48%, ENSRNOG00000032539: 34%
Entrez Gene ID: 26206
Uniprot ID: Q99932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPAG8
Alternative Gene Name: BS-84, CILD28, CT142, HSD-1, hSMP-1, SPAG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066196: 48%, ENSRNOG00000032539: 34%
Entrez Gene ID: 26206
Uniprot ID: Q99932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVPNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKP |
Documents & Links for Anti SPAG8 pAb (ATL-HPA068012 w/enhanced validation) | |
Datasheet | Anti SPAG8 pAb (ATL-HPA068012 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPAG8 pAb (ATL-HPA068012 w/enhanced validation) at Atlas |
Documents & Links for Anti SPAG8 pAb (ATL-HPA068012 w/enhanced validation) | |
Datasheet | Anti SPAG8 pAb (ATL-HPA068012 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPAG8 pAb (ATL-HPA068012 w/enhanced validation) |
Citations for Anti SPAG8 pAb (ATL-HPA068012 w/enhanced validation) – 1 Found |
Djureinovic, Dijana; Hallström, Björn M; Horie, Masafumi; Mattsson, Johanna Sofia Margareta; La Fleur, Linnea; Fagerberg, Linn; Brunnström, Hans; Lindskog, Cecilia; Madjar, Katrin; Rahnenführer, Jörg; Ekman, Simon; Ståhle, Elisabeth; Koyi, Hirsh; Brandén, Eva; Edlund, Karolina; Hengstler, Jan G; Lambe, Mats; Saito, Akira; Botling, Johan; Pontén, Fredrik; Uhlén, Mathias; Micke, Patrick. Profiling cancer testis antigens in non-small-cell lung cancer. Jci Insight. 2016;1(10):e86837. PubMed |