Anti SPAG7 pAb (ATL-HPA052394)

Atlas Antibodies

SKU:
ATL-HPA052394-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sperm associated antigen 7
Gene Name: SPAG7
Alternative Gene Name: ACRP, FSA-1, MGC20134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018287: 97%, ENSRNOG00000004246: 96%
Entrez Gene ID: 9552
Uniprot ID: O75391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGC
Gene Sequence DDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGC
Gene ID - Mouse ENSMUSG00000018287
Gene ID - Rat ENSRNOG00000004246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPAG7 pAb (ATL-HPA052394)
Datasheet Anti SPAG7 pAb (ATL-HPA052394) Datasheet (External Link)
Vendor Page Anti SPAG7 pAb (ATL-HPA052394) at Atlas Antibodies

Documents & Links for Anti SPAG7 pAb (ATL-HPA052394)
Datasheet Anti SPAG7 pAb (ATL-HPA052394) Datasheet (External Link)
Vendor Page Anti SPAG7 pAb (ATL-HPA052394)