Anti SPAG1 pAb (ATL-HPA053682 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053682-25

• 

Protein Description: sperm associated antigen 1
Gene Name: SPAG1
Alternative Gene Name: CT140, FLJ32920, HSD-3.8, SP75, TPIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037617: 86%, ENSRNOG00000010078: 87%
Entrez Gene ID: 6674
Uniprot ID: Q07617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYT
• Gene Sequence: KKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYT
• Gene ID - Mouse: ENSMUSG00000037617
• Gene ID - Rat: ENSRNOG00000010078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.