Anti SPACA7 pAb (ATL-HPA048349 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048349-25

• 

Protein Description: sperm acrosome associated 7
Gene Name: SPACA7
Alternative Gene Name: C13orf28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010435: 43%, ENSRNOG00000054006: 36%
Entrez Gene ID: 122258
Uniprot ID: Q96KW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQIL
• Gene Sequence: AGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQIL
• Gene ID - Mouse: ENSMUSG00000010435
• Gene ID - Rat: ENSRNOG00000054006
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.