Anti SPACA5 pAb (ATL-HPA047149)

Atlas Antibodies

SKU: ATL-HPA047149-25

• 

Protein Description: sperm acrosome associated 5
Gene Name: SPACA5
Alternative Gene Name: dJ54B20.3, LYC5, LYZL5, PNPK6288, SLLP2, UNQ6288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037167: 63%, ENSRNOG00000045622: 68%
Entrez Gene ID: 389852
Uniprot ID: Q96QH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHC
• Gene Sequence: MDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHC
• Gene ID - Mouse: ENSMUSG00000037167
• Gene ID - Rat: ENSRNOG00000045622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.