Anti SP8 pAb (ATL-HPA054006)

Atlas Antibodies

SKU: ATL-HPA054006-25

• 
• 

Protein Description: Sp8 transcription factor
Gene Name: SP8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048562: 93%, ENSRNOG00000005943: 93%
Entrez Gene ID: 221833
Uniprot ID: Q8IXZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDVQNPNSA
• Gene Sequence: HPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDVQNPNSA
• Gene ID - Mouse: ENSMUSG00000048562
• Gene ID - Rat: ENSRNOG00000005943
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SP8 pAb (ATL-HPA054006) – 2 Found

Sun, Yishan; Paşca, Sergiu P; Portmann, Thomas; Goold, Carleton; Worringer, Kathleen A; Guan, Wendy; Chan, Karen C; Gai, Hui; Vogt, Daniel; Chen, Ying-Jiun J; Mao, Rong; Chan, Karrie; Rubenstein, John Lr; Madison, Daniel V; Hallmayer, Joachim; Froehlich-Santino, Wendy M; Bernstein, Jonathan A; Dolmetsch, Ricardo E. A deleterious Nav1.1 mutation selectively impairs telencephalic inhibitory neurons derived from Dravet Syndrome patients. Elife. 2016;5( 27458797) 

Rosebrock, Daniel; Arora, Sneha; Mutukula, Naresh; Volkman, Rotem; Gralinska, Elzbieta; Balaskas, Anastasios; Aragonés Hernández, Amèlia; Buschow, René; Brändl, Björn; Müller, Franz-Josef; Arndt, Peter F; Vingron, Martin; Elkabetz, Yechiel. Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells. Nature Cell Biology. 2022;24(6):981-995.