Protein Description: Sp7 transcription factor
Gene Name: SP7
Alternative Gene Name: osterix, OSX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060284: 99%, ENSRNOG00000014082: 99%
Entrez Gene ID: 121340
Uniprot ID: Q8TDD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SP7
Alternative Gene Name: osterix, OSX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060284: 99%, ENSRNOG00000014082: 99%
Entrez Gene ID: 121340
Uniprot ID: Q8TDD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSG |
| Documents & Links for Anti SP7 pAb (ATL-HPA063202) | |
| Datasheet | Anti SP7 pAb (ATL-HPA063202) Datasheet (External Link) |
| Vendor Page | Anti SP7 pAb (ATL-HPA063202) at Atlas |
| Documents & Links for Anti SP7 pAb (ATL-HPA063202) | |
| Datasheet | Anti SP7 pAb (ATL-HPA063202) Datasheet (External Link) |
| Vendor Page | Anti SP7 pAb (ATL-HPA063202) |